Chengdu Kaijie bio medicine Peptide API
GLP-1(7-36) Product description
GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460).
Both GLP-1 (7-36) and GLP-1 (7-37)-Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles.
DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36)-Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
GLP-1(7-36) Chemical Properties
Product Name | Glucagon – Like Peptide 1, GLP – 1 (7 – 36), amide, human |
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR – NH2 | |
Size | 1 mg |
Catalog # | AS-22463 |
US$ | $231 |
Purity | % Peak Area By HPLC ≥ 95% |
Detailed Information | Datasheet |
Material Safety Data Sheets (MSDS) | |
Storage | -20°C |
References | Drucker, D. et al. Proc Natl Acad Sci USA 84, 3434 (1987) |
Kieffer, T. and J. Habener, Endo Rev 20, 876 (1999) | |
Deacon, CF. et. al. Hormone Metabolic Res 36,761 (2004), doi: 10.1055/s-2004-826160 | |
Williams, JA. Pancreadepedia (2014), doi: 10.3998/panc.2014.7 | |
Elahi, D. et. al. Obesity (Silver Spring) 16, 1501 (2008), doi: 10.1038/oby.2008.229 | |
Ban, K. et. al. Endocrinol 151, 1520 (2010), doi: http://dx.doi.org/10.1210/en.2009-1197 | |
Molecular Weight | 3297.7 |
Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
(One-Letter Code) | |
Sequence | H – His – Ala – Glu – Gly – Thr – Phe – Thr – Ser – Asp – Val – Ser – Ser – Tyr – Leu – Glu – Gly – Gln – Ala – Ala – Lys – Glu – Phe – Ile – Ala – Trp – Leu – Val – Lys – Gly – Arg – NH2 |
(Three-Letter Code) | |
Product Citations | Tashiro Y et al. (2014) A glucagon-like peptide-1 analog liraglutide suppresses macrophage foam cell formation and atherosclerosis; Peptides 54, 19-26. |
Puddu A et al. (2010) Glucagon-like peptide-1 counteracts the detrimental effects of Advanced Glycation End-Products in the pancreatic beta cell line HIT-T 15. Biochem Biophys Res Commun 398, 462. |
Polypeptide Production Specifications
CAS Registry Number | 128270-60-0 |
---|---|
Categories | APIsPeptides; Biopharmaceuticals |
Sales markets | Western Europe; Asia; North America; Central/South America |
Supplied from | China |
Selling Points | International Approvals/Standards |
CPhIonline Consultation details
Other Polypeptide APIs Products
peptide synthesis companies
Polypeptide APIs Products |
US-DMF LIST |
Beauty peptides |
Chinese cGMP APIs |
Mexico Registered APIs |
Research Peptide APIs for Regulatory Market |
Polypeptide Preparation |
Kaijie bio medicine Peptide APIs |
How many companies are there in peptide api manufacturer in china? The peptide api market is very promising, and the world is encouraging the development of peptide business. There is a peptide api list on the website Biofda.com, which contains various specifications of peptide APIs for customers to choose from. Shengnuo Technology is a peptide api manufacturer located in Chengdu, a city in southwest China. Not only peptide APIs, but also carnosine custom suppliers and cosmetic peptide suppliers
There are many peptide apis manufacture in China, but they are all small-scale companies. The China peptide company such as Sinotech is a leading company in China and has a very high position.
As a Chinese peptide company, Sinotech has been working silently, hoping to become a top peptide company in the world. There are many countries producing peptides in the world, such as bulk drug substance in India, gmp custom peptide in uk, and peptide production in usa. So what is polypeptide? What kind of peptide synthesis supplier should you choose? Follow our website: www.biofda.com, here will tell you the answer.